Structure of PDB 2ke1 Chain A Binding Site BS01

Receptor Information
>2ke1 Chain A (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMAQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCS
SCLQATVQEVQPRAEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ke1 The solution structure of the first PHD finger of autoimmune regulator in complex with non-modified histone H3 tail reveals the antagonistic role of H3R2 methylation
ResolutionN/A
Binding residue
(original residue number in PDB)		Q293 N295 E296 D297 E298 D304 G305 G306 E307 L308 I309 C310 C311 D312 I330 P331 G333
Binding residue
(residue number reindexed from 1)		Q5 N7 E8 D9 E10 D16 G17 G18 E19 L20 I21 C22 C23 D24 I42 P43 G45
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2ke1, PDBe:2ke1, PDBj:2ke1
PDBsum2ke1
PubMed19293276
UniProtO43918|AIRE_HUMAN Autoimmune regulator (Gene Name=AIRE)

[Back to BioLiP]