Structure of PDB 2kdz Chain A Binding Site BS01

Receptor Information
>2kdz Chain A (length=107) Species: 5722 (Trichomonas vaginalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVKFTEEEDLKLQQLVMRYGAKDWIRISQLMITRNPRQCRERWNNYINPA
LRTDPWSPEEDMLLDQKYAEYGPKWNKISKFLKNRSDNNIRNRWMMIARH
RAKHQKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kdz NMR structural analysis of DNA recognition by a novel Myb1 DNA-binding domain in the protozoan parasite Trichomonas vaginalis.
ResolutionN/A
Binding residue
(original residue number in PDB)		K3 F4 T33 R34 N35 Q38 E41 R42 N88 N92 R93 M96
Binding residue
(residue number reindexed from 1)		K3 F4 T33 R34 N35 Q38 E41 R42 N88 N92 R93 M96
Binding affinityPDBbind-CN: Kd=1.24nM
Enzymatic activity
Enzyme Commision number ?
External links