Structure of PDB 2kbm Chain A Binding Site BS01

Receptor Information
>2kbm Chain A (length=93) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSSFLDVQKD
ADAVDKIMKELDENGDGEVDFQEFVVLVAALTVACNNFFWENS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2kbm Solution structure of Ca-S100A1-TRTK12
ResolutionN/A
Binding residue
(original residue number in PDB)
F44 D46 K49 I57 E60 L81 A84 C85
Binding residue
(residue number reindexed from 1)
F44 D46 K49 I57 E60 L81 A84 C85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0044548 S100 protein binding
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
GO:0051117 ATPase binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0008016 regulation of heart contraction
GO:1903672 positive regulation of sprouting angiogenesis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0016529 sarcoplasmic reticulum
GO:0030018 Z disc
GO:0031430 M band
GO:0031672 A band
GO:0031674 I band

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2kbm, PDBe:2kbm, PDBj:2kbm
PDBsum2kbm
PubMed
UniProtP35467|S10A1_RAT Protein S100-A1 (Gene Name=S100a1)

[Back to BioLiP]