Structure of PDB 2kae Chain A Binding Site BS01

Receptor Information

>2kae Chain A (length=56) Species: 6239 (Caenorhabditis elegans)

SFQCSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQK
RKLKVQ

Ligand information

>2kae Chain C (length=20)

cggaaaagtatacttttccg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2kae Structural Analysis of MED-1 Reveals Unexpected Diversity in the Mechanism of DNA Recognition by GATA-type Zinc Finger Domains.
• Resolution: N/A
• Binding residue (original residue number in PDB): I123 R124 R129 I141 Y142 R144 K145 Y146 R150 Y158 K162 Q166
• Binding residue (residue number reindexed from 1): I13 R14 R19 I31 Y32 R34 K35 Y36 R40 Y48 K52 Q56
• Binding affinity: PDBbind-CN: Kd=8nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Feb 17 00:09:15 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '2kae', asym_id = 'A', bs = 'BS01', title = 'Structural Analysis of MED-1 Reveals Unexpected ...DNA Recognition by GATA-type Zinc Finger Domains.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='2kae', asym_id='A', bs='BS01', title='Structural Analysis of MED-1 Reveals Unexpected ...DNA Recognition by GATA-type Zinc Finger Domains.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0006355,0008270,0043565', uniprot = '', pdbid = '2kae', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006355,0008270,0043565', uniprot='', pdbid='2kae', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>