Structure of PDB 2k9u Chain A Binding Site BS01

Receptor Information
>2k9u Chain A (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIPEFFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGG
LSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSP
FVVPVASLSDDARRLTVTS
Ligand information
>2k9u Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MASKPEKRVASSVFITLAPPRRDV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2k9u Migfilin, a molecular switch in regulation of integrin activation.
ResolutionN/A
Binding residue
(original residue number in PDB)		G49 L51 S52 I53 V55 E56 G57 P58 K60 E86
Binding residue
(residue number reindexed from 1)		G49 L51 S52 I53 V55 E56 G57 P58 K60 E86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051015 actin filament binding
Biological Process
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2k9u, PDBe:2k9u, PDBj:2k9u
PDBsum2k9u
PubMed19074766
UniProtQ14315|FLNC_HUMAN Filamin-C (Gene Name=FLNC)

[Back to BioLiP]