Structure of PDB 2k7o Chain A Binding Site BS01

Receptor Information
>2k7o Chain A (length=91) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQ
EVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
Ligand information
Ligand IDCA
InChIInChI=1S/Ca/q+2
InChIKeyBHPQYMZQTOCNFJ-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Ca++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0
[Ca+2]
FormulaCa
NameCALCIUM ION
ChEMBL
DrugBankDB14577
ZINC
PDB chain2k7o Chain A Residue 101 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2k7o Refinement of the solution structure and dynamic properties of Ca(2+)-bound rat S100B.
ResolutionN/A
Binding residue
(original residue number in PDB)
S18 E21 K26 E31
Binding residue
(residue number reindexed from 1)
S18 E21 K26 E31
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0044548 S100 protein binding
GO:0046872 metal ion binding
GO:0048156 tau protein binding
GO:0048306 calcium-dependent protein binding
GO:0050786 RAGE receptor binding
Biological Process
GO:0007155 cell adhesion
GO:0007611 learning or memory
GO:0007613 memory
GO:0008284 positive regulation of cell population proliferation
GO:0008360 regulation of cell shape
GO:0031643 positive regulation of myelination
GO:0043065 positive regulation of apoptotic process
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0045666 positive regulation of neuron differentiation
GO:0048168 regulation of neuronal synaptic plasticity
GO:0048708 astrocyte differentiation
GO:0050806 positive regulation of synaptic transmission
GO:0051384 response to glucocorticoid
GO:0051597 response to methylmercury
GO:0060291 long-term synaptic potentiation
GO:0071456 cellular response to hypoxia
GO:0097490 sympathetic neuron projection extension
GO:1990138 neuron projection extension
GO:1990845 adaptive thermogenesis
GO:2001015 negative regulation of skeletal muscle cell differentiation
Cellular Component
GO:0001726 ruffle
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0043025 neuronal cell body
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2k7o, PDBe:2k7o, PDBj:2k7o
PDBsum2k7o
PubMed18949447
UniProtP04631|S100B_RAT Protein S100-B (Gene Name=S100b)

[Back to BioLiP]