Structure of PDB 2k7l Chain A Binding Site BS01

Receptor Information
>2k7l Chain A (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRL
NPERKMINDKMHFSLKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2k7l NMR structure of a complex formed by the carboxyl-terminal domain of human RAP74 and a phosphorylated peptide from the central domain of the FCP1 phosphatase
ResolutionN/A
Binding residue
(original residue number in PDB)		T470 K471 L474 E487 V490 A494 L497 K498 M511 F513
Binding residue
(residue number reindexed from 1)		T20 K21 L24 E37 V40 A44 L47 K48 M61 F63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2k7l, PDBe:2k7l, PDBj:2k7l
PDBsum2k7l
PubMed19215094
UniProtP35269|T2FA_HUMAN General transcription factor IIF subunit 1 (Gene Name=GTF2F1)

[Back to BioLiP]