Structure of PDB 2k7f Chain A Binding Site BS01

Receptor Information
>2k7f Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLIFVITGVLESIERD
EAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDG
LLNLIRNLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2k7f Structure of the DNA-bound BRCA1 C-terminal region from human replication factor C p140 and model of the protein-DNA complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y385 R388 K436 T438 R452 S454 G455 Q456 S457
Binding residue
(residue number reindexed from 1)		Y11 R14 K62 T64 R78 S80 G81 Q82 S83
Binding affinityPDBbind-CN: Kd=10nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2k7f, PDBe:2k7f, PDBj:2k7f
PDBsum2k7f
PubMed20081198
UniProtP35251|RFC1_HUMAN Replication factor C subunit 1 (Gene Name=RFC1)

[Back to BioLiP]