Structure of PDB 2k3w Chain A Binding Site BS01

Receptor Information
>2k3w Chain A (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKA
KESIRAKCVQYLDRAEKLKDYLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2k3w Two distinct modes of ESCRT-III recognition are required for VPS4 functions in lysosomal protein targeting and HIV-1 budding
ResolutionN/A
Binding residue
(original residue number in PDB)
T17 D20 K21 Y32 F39 A52 K59 Y63 R66 Y73
Binding residue
(residue number reindexed from 1)
T15 D18 K19 Y30 F37 A50 K57 Y61 R64 Y71
Enzymatic activity
Enzyme Commision number 3.6.4.6: vesicle-fusing ATPase.
External links
PDB RCSB:2k3w, PDBe:2k3w, PDBj:2k3w
PDBsum2k3w
PubMed18606141
UniProtQ9UN37|VPS4A_HUMAN Vacuolar protein sorting-associated protein 4A (Gene Name=VPS4A)

[Back to BioLiP]