Structure of PDB 2k3u Chain A Binding Site BS01

Receptor Information
>2k3u Chain A (length=91) Species: 426430 (Staphylococcus aureus subsp. aureus str. Newman) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPL
AEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Ligand information
>2k3u Chain B (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TTPDYGHYDDKDTLDLNTPVDK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2k3u Structure of the Tyrosine-sulfated C5a Receptor N Terminus in Complex with Chemotaxis Inhibitory Protein of Staphylococcus aureus.
ResolutionN/A
Binding residue
(original residue number in PDB)		R44 Y48 K51 G52 T53 K54 N55 Q58 K61 Y97 F99 S104 K105 S106 S107 Y108 V109 N111
Binding residue
(residue number reindexed from 1)		R14 Y18 K21 G22 T23 K24 N25 Q28 K31 Y67 F69 S74 K75 S76 S77 Y78 V79 N81
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2k3u, PDBe:2k3u, PDBj:2k3u
PDBsum2k3u
PubMed19251703
UniProtA6QIG7|CHIPS_STAAE Chemotaxis inhibitory protein (Gene Name=chp)

[Back to BioLiP]