Structure of PDB 2k1n Chain A Binding Site BS01

Receptor Information
>2k1n Chain A (length=55) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKP
NMTCQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2k1n Insights into the Nature of DNA Binding of AbrB-like Transcription Factors
ResolutionN/A
Binding residue
(original residue number in PDB)		L13 R15
Binding residue
(residue number reindexed from 1)		L13 R15
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2k1n, PDBe:2k1n, PDBj:2k1n
PDBsum2k1n
PubMed19000822
UniProtP08874|ABRB_BACSU Transition state regulatory protein AbrB (Gene Name=abrB)

[Back to BioLiP]