Structure of PDB 2jzw Chain A Binding Site BS01

Receptor Information

>2jzw Chain A (length=44) Species: 11678 (Human immunodeficiency virus type 1 BH10)

NVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN

Ligand information

>2jzw Chain B (length=14)

gtccctgttcgggc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2jzw How the HIV-1 nucleocapsid protein binds and destabilises the (-)primer binding site during reverse transcription.
• Resolution: N/A
• Binding residue (original residue number in PDB): N12 V13 F16 N17 G22 T24 A25 R26 N27 C28 R29 A30 R32 K33 K34 G35 C36 W37 Q45 M46 K47
• Binding residue (residue number reindexed from 1): N1 V2 F5 N6 G11 T13 A14 R15 N16 C17 R18 A19 R21 K22 K23 G24 C25 W26 Q34 M35 K36

Enzymatic activity

• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.
  3.4.23.16: HIV-1 retropepsin.

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008270 zinc ion binding

External links

• PDB: RCSB:2jzw, PDBe:2jzw, PDBj:2jzw
• PDBsum: 2jzw
• PubMed: 18773912
• UniProt: P03366|POL_HV1B1 Gag-Pol polyprotein (Gene Name=gag-pol)