Structure of PDB 2jw1 Chain A Binding Site BS01

Receptor Information
>2jw1 Chain A (length=115) Species: 623 (Shigella flexneri) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSSNSEKEWHIVPVSKDYFSIPNDLLWSFNTTNKSINVYSKCISGKAVYS
FNAGKFMGNFNVKEVDGCFMDAQKIAIDKLFSMLKDGVVLKGNKINDTIL
IEKDGEVKLKLIRGI
Ligand information
>2jw1 Chain B (length=18) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SETTLLEDEKSLVSYLNY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jw1 Structural Characterization of the Type-III Pilot-Secretin Complex from Shigella flexneri
ResolutionN/A
Binding residue
(original residue number in PDB)		S28 S29 N31 K34 W36 F56 T58 K61 F78 G81 V116 L117 K118 G119 I122 N123 D124 T125 I126
Binding residue
(residue number reindexed from 1)		S1 S2 N4 K7 W9 F29 T31 K34 F51 G54 V89 L90 K91 G92 I95 N96 D97 T98 I99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Cellular Component
GO:0009279 cell outer membrane

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2jw1, PDBe:2jw1, PDBj:2jw1
PDBsum2jw1
PubMed18940609
UniProtP0A1X2|SCTG_SHIFL Type 3 secretion system pilotin (Gene Name=mxiM)

[Back to BioLiP]