Structure of PDB 2jpa Chain A Binding Site BS01

Receptor Information
>2jpa Chain A (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSR
SDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWP
SCQKKFARSDELVRHHNMH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jpa Structure of the wilms tumor suppressor protein zinc finger domain bound to DNA
ResolutionN/A
Binding residue
(original residue number in PDB)		Q25 M26 R29 F48 R50 Q53 R56 H57 R60 R74 R78 H81 H85 T88 R108 E111 R114
Binding residue
(residue number reindexed from 1)		Q25 M26 R29 F48 R50 Q53 R56 H57 R60 R74 R78 H81 H85 T88 R108 E111 R114
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2jpa, PDBe:2jpa, PDBj:2jpa
PDBsum2jpa
PubMed17716689
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]