Structure of PDB 2jp9 Chain A Binding Site BS01

Receptor Information
>2jp9 Chain A (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSR
SDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWP
SCQKKFARSDELVRHHNMH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jp9 Structure of the wilms tumor suppressor protein zinc finger domain bound to DNA
ResolutionN/A
Binding residue
(original residue number in PDB)		M26 R29 F48 R50 Q53 R56 H57 R60 R74 R78 H81 H85 R108 E111 R114
Binding residue
(residue number reindexed from 1)		M26 R29 F48 R50 Q53 R56 H57 R60 R74 R78 H81 H85 R108 E111 R114
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2jp9, PDBe:2jp9, PDBj:2jp9
PDBsum2jp9
PubMed17716689
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]