Structure of PDB 2jo9 Chain A Binding Site BS01

Receptor Information
>2jo9 Chain A (length=31) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLPPGWEKRTDSNGRVYFVNHNTRITQWEDP
Ligand information
>2jo9 Chain B (length=9) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEPPPPYED
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jo9 NMR Structural Studies of the ItchWW3 Domain Reveal that Phosphorylation at T30 Inhibits the Interaction with PPxY-Containing Ligands
ResolutionN/A
Binding residue
(original residue number in PDB)		R13 R19 Y21 V23 H25 R28 T30 W32
Binding residue
(residue number reindexed from 1)		R9 R15 Y17 V19 H21 R24 T26 W28
Enzymatic activity
Enzyme Commision number 2.3.2.26: HECT-type E3 ubiquitin transferase.
External links
PDB RCSB:2jo9, PDBe:2jo9, PDBj:2jo9
PDBsum2jo9
PubMed17437719
UniProtQ8C863|ITCH_MOUSE E3 ubiquitin-protein ligase Itchy (Gene Name=Itch)

[Back to BioLiP]