Structure of PDB 2jnw Chain A Binding Site BS01

Receptor Information
>2jnw Chain A (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNL
HPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLIL
AWSPEEAGRYLETYKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jnw Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA
ResolutionN/A
Binding residue
(original residue number in PDB)		R106 R108 N110 F140 L141 S142 R144 Y145 Y152
Binding residue
(residue number reindexed from 1)		R8 R10 N12 F42 L43 S44 R46 Y47 Y54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003684 damaged DNA binding
Biological Process
GO:0006281 DNA repair
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2jnw, PDBe:2jnw, PDBj:2jnw
PDBsum2jnw
PubMed17948053
UniProtP07992|ERCC1_HUMAN DNA excision repair protein ERCC-1 (Gene Name=ERCC1)

[Back to BioLiP]