Structure of PDB 2jnd Chain A Binding Site BS01

Receptor Information
>2jnd Chain A (length=79) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YCHRTTIGNFSGPYTYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKY
NTTRNAYRECLENGTWASRVNYSHCEPIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jnd Structure of the N-terminal domain of a type B1 G protein-coupled receptor in complex with a peptide ligand
ResolutionN/A
Binding residue
(original residue number in PDB)		D65 Q66 I67 C84 P85 E86 F88 N89 I91 V113 Y115 C118 E119 P120
Binding residue
(residue number reindexed from 1)		D22 Q23 I24 C41 P42 E43 F45 N46 I48 V70 Y72 C75 E76 P77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2jnd, PDBe:2jnd, PDBj:2jnd
PDBsum2jnd
PubMed17360332
UniProtQ60748|CRFR2_MOUSE Corticotropin-releasing factor receptor 2 (Gene Name=Crhr2)

[Back to BioLiP]