Structure of PDB 2jmj Chain A Binding Site BS01

Receptor Information
>2jmj Chain A (length=60) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEEVYCFCRNVSYGPMVACDNPACPFEWFHYGCVGLKQAPKGKWYCSKDC
KEIANQRSKS
Ligand information
>2jmj Chain P (length=9) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARTKQTARK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jmj Yng1 PHD finger binding to H3 trimethylated at K4 promotes NuA3 HAT activity at K14 of H3 and transcription at a subset of targeted ORFs
ResolutionN/A
Binding residue
(original residue number in PDB)		Y28 S35 G37 P38 M39 V40 A41 D43 E50 W51 K60 K66 W67
Binding residue
(residue number reindexed from 1)		Y5 S12 G14 P15 M16 V17 A18 D20 E27 W28 K37 K43 W44
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2jmj, PDBe:2jmj, PDBj:2jmj
PDBsum2jmj
PubMed17157260
UniProtQ08465|YNG1_YEAST Protein YNG1 (Gene Name=YNG1)

[Back to BioLiP]