Structure of PDB 2jma Chain A Binding Site BS01

Receptor Information
>2jma Chain A (length=62) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDETGKELVLALYDYQEKSPAEVTMKKGDILTLLNSTNKDWWKVEVNDRQ
GFVPAAYVKKLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jma The high-resolution NMR structure of the R21A Spc-SH3:P41 complex: Understanding the determinants of binding affinity by comparison with Abl-SH3
ResolutionN/A
Binding residue
(original residue number in PDB)
Y13 K18 E22 D40 W41 F52 Y57
Binding residue
(residue number reindexed from 1)
Y13 K18 E22 D40 W41 F52 Y57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2jma, PDBe:2jma, PDBj:2jma
PDBsum2jma
PubMed17407569
UniProtP07751|SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 (Gene Name=SPTAN1)

[Back to BioLiP]