Structure of PDB 2jkg Chain A Binding Site BS01

Receptor Information

>2jkg Chain A (length=165) Species: 5833 (Plasmodium falciparum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YSWDSYLNDRLLATNQVSGAGLASEEDGVVYACVAQGEESDPNFDKWSLF
YKEDYDIEVEDENGTKTTKTINEGQTILVVFNEGYAPDGVWLGGTKYQFI
NIERDLEFEGYNFDVATCAKLKGGLHLVKVPGGNILVVLYDEEKEQDRGN
SKIAALTFAKELAES

Ligand information

>2jkg Chain P (length=8) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PPPPPPPP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2jkg Structural Basis for Parasite-Specific Functions of the Divergent Profilin of Plasmodium Falciparum.
Resolution	1.89 Å
Binding residue (original residue number in PDB)	Y5 S6 W7 Y35
Binding residue (residue number reindexed from 1)	Y1 S2 W3 Y31

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003779	actin binding
GO:0003785	actin monomer binding
GO:0005515	protein binding
GO:0005543	phospholipid binding
GO:0008289	lipid binding

	Biological Process
GO:0030036	actin cytoskeleton organization
GO:0042989	sequestering of actin monomers
GO:0060327	cytoplasmic actin-based contraction involved in cell motility

	Cellular Component
GO:0005737	cytoplasm
GO:0005856	cytoskeleton
GO:0005938	cell cortex
GO:0015629	actin cytoskeleton

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2jkg, PDBe:2jkg, PDBj:2jkg
PDBsum	2jkg
PubMed	19000816
UniProt	Q8I2J4\|PROF_PLAF7 Profilin (Gene Name=Pfn)

[Back to BioLiP]