Structure of PDB 2jgb Chain A Binding Site BS01

Receptor Information
>2jgb Chain A (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQF
WRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLA
SRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTA
RIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGPQRLLF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jgb Structures of the human eIF4E homologous protein, h4EHP, in its m7GTP-bound and unliganded forms.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		H54 P55 Q57 Y58 V91 E92 W95 N150 L153 G157 E158 Q159 M161 G163
Binding residue
(residue number reindexed from 1)		H10 P11 Q13 Y14 V47 E48 W51 N106 L109 G113 E114 Q115 M117 G119
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
Biological Process
GO:0006413 translational initiation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2jgb, PDBe:2jgb, PDBj:2jgb
PDBsum2jgb
PubMed17368478
UniProtO60573|IF4E2_HUMAN Eukaryotic translation initiation factor 4E type 2 (Gene Name=EIF4E2)

[Back to BioLiP]