Structure of PDB 2jdl Chain A Binding Site BS01

Receptor Information
>2jdl Chain A (length=247) Species: 3677 (Trichosanthes kirilowii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALI
HLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAM
RKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASA
LMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQ
IASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jdl The C-Terminal Fragment of the Ribosomal P Protein Complexed to Trichosanthin Reveals the Interaction between the Ribosome-Inactivating Protein and the Ribosome.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		F166 Q169 Q170 K173 R174 L188 N217 A218 Q219 V223 I225 A230 G231 V232 S235
Binding residue
(residue number reindexed from 1)		F166 Q169 Q170 K173 R174 L188 N217 A218 Q219 V223 I225 A230 G231 V232 S235
Enzymatic activity
Catalytic site (original residue number in PDB) I71 E160 R163
Catalytic site (residue number reindexed from 1) I71 E160 R163
Enzyme Commision number 3.2.2.22: rRNA N-glycosylase.
Gene Ontology
Molecular Function
GO:0016787 hydrolase activity
GO:0030598 rRNA N-glycosylase activity
GO:0090729 toxin activity
Biological Process
GO:0006952 defense response
GO:0017148 negative regulation of translation
GO:0035821 modulation of process of another organism
GO:0050688 regulation of defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2jdl, PDBe:2jdl, PDBj:2jdl
PDBsum2jdl
PubMed19073700
UniProtP09989|RIPT_TRIKI Ribosome-inactivating protein alpha-trichosanthin

[Back to BioLiP]