Structure of PDB 2jby Chain A Binding Site BS01

Receptor Information
>2jby Chain A (length=127) Species: 10273 (Myxoma virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSRLKTAVYDYLNDVDITECTEMDLLCQLSNCCDFINETYAKNYDTLYDI
MERDILSYNIVNIKNTLTFALRDASPSVKLATLTLLASVIKKLNKIQHTD
AAMFSEVIDGIVAEEQQVIGFIQKKCK
Ligand information
>2jby Chain B (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SSTMGQVGRQLAIIGDDINRRYDSE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2jby A structural viral mimic of prosurvival Bcl-2: a pivotal role for sequestering proapoptotic Bax and Bak.
Resolution2.41 Å
Binding residue
(original residue number in PDB)		Y41 N44 T47 L48 I51 N66 T67 S76 S78 A82 F122
Binding residue
(residue number reindexed from 1)		Y40 N43 T46 L47 I50 N65 T66 S75 S77 A81 F121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0033668 symbiont-mediated suppression of host apoptosis
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:2jby, PDBe:2jby, PDBj:2jby
PDBsum2jby
PubMed17386268
UniProtQ85295

[Back to BioLiP]