Structure of PDB 2j7i Chain A Binding Site BS01

Receptor Information
>2j7i Chain A (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFP
DNFVKEIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2j7i Atypical Polyproline Recognition by the Cms N-Terminal Src Homology 3 Domain.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
Y8 D16 E34 E35 W37 M48 N52 F53
Binding residue
(residue number reindexed from 1)
Y8 D16 E34 E35 W37 M48 N52 F53
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2j7i, PDBe:2j7i, PDBj:2j7i
PDBsum2j7i
PubMed17020880
UniProtQ9Y5K6|CD2AP_HUMAN CD2-associated protein (Gene Name=CD2AP)

[Back to BioLiP]