Structure of PDB 2izx Chain A Binding Site BS01

Receptor Information
>2izx Chain A (length=39) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREAR
Ligand information
>2izx Chain C (length=18) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QIEYLAKQIVDNAIQQAK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2izx Molecular Basis of Akap Specificity for Pka Regulatory Subunits.
Resolution1.3 Å
Binding residue
(original residue number in PDB)
I5 T10 L13 Q14 T17
Binding residue
(residue number reindexed from 1)
I1 T6 L9 Q10 T13
Enzymatic activity
Enzyme Commision number 2.7.11.11: cAMP-dependent protein kinase.
External links
PDB RCSB:2izx, PDBe:2izx, PDBj:2izx
PDBsum2izx
PubMed17081989
UniProtP13861|KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit (Gene Name=PRKAR2A)

[Back to BioLiP]