Structure of PDB 2iy5 Chain A Binding Site BS01

Receptor Information
>2iy5 Chain A (length=336) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAA
LEAREKALEEAALKEALERERVDVSLPGASLFSGGLHPITLMERELVEIF
RALGYQAVEGPEVESEFFNFDALNIPEHHPARDMWDTFWLTGEGFRLEGP
LGEEVEGRLLLRTHTSPMQVRYMVAHTPPFRIVVPGRVFRFEQTDATHEA
VFHQLEGLVVGEGIAMAHLKGAIYELAQALFGPDSKVRFQPVYFPFVEPG
AQFAVWWPEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYRGVTGFA
FGLGVERLAMLRYGIPDIRYFFGGRLKFLEQFKGVL
Ligand information
>2iy5 Chain T (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccgagguagcucaguugguagagcaugcgacugaaaaucgcaguguccg
cgguucgauuccgcgccucggcacca
.<<<<<<..<<<<........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2iy5 The crystal structure of the ternary complex of phenylalanyl-tRNA synthetase with tRNAPhe and a phenylalanyl-adenylate analogue reveals a conformational switch of the CCA end.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		E17 L21 A23 R24 Y25 Q34 L39 L42 R50 E53 L54 I57 L65
Binding residue
(residue number reindexed from 1)		E3 L7 A9 R10 Y11 Q20 L25 L28 R36 E39 L40 I43 L51
Enzymatic activity
Catalytic site (original residue number in PDB) W149 H178 R204 Q218 V261 A314
Catalytic site (residue number reindexed from 1) W135 H164 R190 Q204 V247 A300
Enzyme Commision number 6.1.1.20: phenylalanine--tRNA ligase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0000166 nucleotide binding
GO:0000287 magnesium ion binding
GO:0004812 aminoacyl-tRNA ligase activity
GO:0004826 phenylalanine-tRNA ligase activity
GO:0005524 ATP binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0006432 phenylalanyl-tRNA aminoacylation
GO:0043039 tRNA aminoacylation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2iy5, PDBe:2iy5, PDBj:2iy5
PDBsum2iy5
PubMed16939209
UniProtQ5SGX2|SYFA_THET8 Phenylalanine--tRNA ligase alpha subunit (Gene Name=pheS)

[Back to BioLiP]