Structure of PDB 2iwb Chain A Binding Site BS01

Receptor Information

>2iwb Chain A (length=246) Species: 158879 (Staphylococcus aureus subsp. aureus N315) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DKYETNVSYKKLNQLAPYFKGFDGSFVLYNEREQAYSIYNEPESKQRYSP
NSTYKIYLALMAFDQNLLSLNHTEQQWDKHQYPFKEWNQDQNLNSSMKYS
VNWYYENLNKHLRQDEVKSYLDLIEYGNEEISGNENYWNESSLKISAIEQ
VNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEA
NGWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI

Ligand information

>2iwb Chain B (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GHMS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2iwb Unbound and Acylated Structures of the Mecr1 Extracellular Antibiotic-Sensor Domain Provide Insights Into the Signal-Transduction System that Triggers Methicillin Resistance.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	L406 H411 Q414 N446 H450
Binding residue (residue number reindexed from 1)	L67 H72 Q75 N107 H111

Enzymatic activity

Catalytic site (original residue number in PDB)	S391 K394 S439 Y444 W477 T531
Catalytic site (residue number reindexed from 1)	S52 K55 S100 Y105 W138 T192
Enzyme Commision number	?

Gene Ontology

	Molecular Function
GO:0008658	penicillin binding

View graph for
Molecular Function

External links

PDB	RCSB:2iwb, PDBe:2iwb, PDBj:2iwb
PDBsum	2iwb
PubMed	16846613
UniProt	P0A0B0\|MECR_STAAN Methicillin resistance mecR1 protein (Gene Name=mecR1)

[Back to BioLiP]