Structure of PDB 2ivh Chain A Binding Site BS01

Receptor Information
>2ivh Chain A (length=124) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFDDFRKK
FWEEVSKDPELSKQFSRNNNDRMKVGKAPKTRTQDVSGKRTSFELHQEKP
ISVYDMDNISVVTPKRHIDIHRGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ivh Structural Basis for Sequence-Dependent DNA Cleavage by Nonspecific Endonucleases.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R496 K525 S540 E542 L543 H544 H569 H573
Binding residue
(residue number reindexed from 1)		R48 K77 S92 E94 L95 H96 H117 H121
Enzymatic activity
Catalytic site (original residue number in PDB) R538 E542 H544 Q545 H569 H573
Catalytic site (residue number reindexed from 1) R90 E94 H96 Q97 H117 H121
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0005102 signaling receptor binding
Biological Process
GO:0009617 response to bacterium
GO:0019835 cytolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ivh, PDBe:2ivh, PDBj:2ivh
PDBsum2ivh
PubMed17175542
UniProtQ47112|CEA7_ECOLX Colicin-E7 (Gene Name=colE7)

[Back to BioLiP]