Structure of PDB 2iui Chain A Binding Site BS01

Receptor Information
>2iui Chain A (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKG
GNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLL
YPVSKYQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2iui Crystal Structure of the Pi 3-Kinase P85 Amino- Terminal Sh2 Domain and its Phosphopeptide Complexes
Resolution2.4 Å
Binding residue
(original residue number in PDB)
R19 R37 S40 T48 L59 I60 K61 S72 D73 P74 Y95 N96 L99
Binding residue
(residue number reindexed from 1)
R15 R33 S36 T44 L55 I56 K57 S68 D69 P70 Y91 N92 L95
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2iui, PDBe:2iui, PDBj:2iui
PDBsum2iui
PubMed8599763
UniProtP27986|P85A_HUMAN Phosphatidylinositol 3-kinase regulatory subunit alpha (Gene Name=PIK3R1)

[Back to BioLiP]