Structure of PDB 2isq Chain A Binding Site BS01

Receptor Information

>2isq Chain A (length=320) Species: 3702 (Arabidopsis thaliana)

SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFS
MISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMS
TERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPA
NPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKL
YGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESI
DMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERY
LSTVLFDATRKEAEAMTFEA

Ligand information

>2isq Chain B (length=8) Species: 3702 (Arabidopsis thaliana)

TEWSDYVI

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2isq Structural basis for interaction of o-acetylserine sulfhydrylase and serine acetyltransferase in the Arabidopsis cysteine synthase complex.
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): T74 S75 G76 T78 G124 M125 K126 G219 P220 H221 Q224 G225
• Binding residue (residue number reindexed from 1): T72 S73 G74 T76 G122 M123 K124 G217 P218 H219 Q222 G223

Enzymatic activity

• Catalytic site (original residue number in PDB): K46 S269
• Catalytic site (residue number reindexed from 1): K44 S267
• Enzyme Commision number: 2.5.1.47: cysteine synthase.

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0004124 cysteine synthase activity
• GO:0005515 protein binding
• GO:0016740 transferase activity

Biological Process

• GO:0006535 cysteine biosynthetic process from serine
• GO:0009567 double fertilization forming a zygote and endosperm
• GO:0009860 pollen tube growth
• GO:0019344 cysteine biosynthetic process
• GO:0046686 response to cadmium ion

Cellular Component

• GO:0000325 plant-type vacuole
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005777 peroxisome
• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0009507 chloroplast
• GO:0009570 chloroplast stroma
• GO:0048046 apoplast

External links

• PDB: RCSB:2isq, PDBe:2isq, PDBj:2isq
• PDBsum: 2isq
• PubMed: 17194764
• UniProt: P47998|CYSK1_ARATH Cysteine synthase 1 (Gene Name=OASA1)