Structure of PDB 2iij Chain A Binding Site BS01

Receptor Information
>2iij Chain A (length=156) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES
EEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCT
YRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFH
INWEDN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2iij Structure of the histone chaperone asf1 bound to the histone h3 C-terminal helix and functional insights.
ResolutionN/A
Binding residue
(original residue number in PDB)		V45 A48 E49 E51 D54 A87 D88 V92 T93 V94 L96 E105 R108 Y112 R145
Binding residue
(residue number reindexed from 1)		V45 A48 E49 E51 D54 A87 D88 V92 T93 V94 L96 E105 R108 Y112 R145
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2iij, PDBe:2iij, PDBj:2iij
PDBsum2iij
PubMed17292837
UniProtQ9Y294|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]