Structure of PDB 2ihn Chain A Binding Site BS01

Receptor Information
>2ihn Chain A (length=299) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDLEMMLDEDYKEGICLIDFSQIALSTALVNFPDKEKINLSMVRHLILNS
IKFNVKKAKTLGYTKIVLCIDNAKSGYWRRDFAYYYKKNRSTWDWEGYFE
SSHKVIDELKAYMPYIVMDIDKYEANDHIAVLVKKFSLEGHKILIISSDG
DFTQLHKYPNVKQWSPMHKKWVKIKSGSAEIDCMTKILKGDKKDNVASVK
VRSDFWFTRVEGERTPSMKTSIVEAIANDREQAKVLLTESEYNRYKENLV
LIDFDYIPDNIASNIVNYYNSYKLPPRGKIYSYFVKAGLSKLTNSINEF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ihn Crystal structure of bacteriophage T4 5' nuclease in complex with a branched DNA reveals how FEN-1 family nucleases bind their substrates.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Q22 S26 L29 A73 K74 W101 F105 H109 S154 G156 K176 K181 K199
Binding residue
(residue number reindexed from 1)		Q22 S26 L29 A73 K74 W95 F99 H103 S148 G150 K170 K175 K193
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0004519 endonuclease activity
GO:0004523 RNA-DNA hybrid ribonuclease activity
GO:0004527 exonuclease activity
GO:0004534 5'-3' RNA exonuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
GO:0017108 5'-flap endonuclease activity
Biological Process
GO:0006260 DNA replication
GO:0033567 DNA replication, Okazaki fragment processing
GO:0043137 DNA replication, removal of RNA primer

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ihn, PDBe:2ihn, PDBj:2ihn
PDBsum2ihn
PubMed17693399
UniProtP13319|RNH_BPT4 Ribonuclease H (Gene Name=rnh)

[Back to BioLiP]