Structure of PDB 2ifw Chain A Binding Site BS01

Receptor Information
>2ifw Chain A (length=206) Species: 5539 (Scytalidium lignicola) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVESNWGGAILIGSDFDTVSATANVPSASGGSSAAGTAWVGIDGDTCQTA
ILQTGFDWYGDGTYDAWYEWYPEVSDDFSGITISEGDSIQMSVTATSDTS
GSATLENLTTGQKVSKSFSNESSGSLCRTNAEFIIEDFEECNSNGSDCEF
VPFASFSPAVEFTDCSVTSDGESVSLDDAQITQVIINNQDVTDCSVSGTT
VSCSYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ifw Crystal structure of scytalidoglutamic peptidase with its first potent inhibitor provides insights into substrate specificity and catalysis.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
N5 W6 T37 G44 D45 Q53 D57 D65 W67 E69 Y71 V74 S75 E136 F138 E139 E140 C141 N142 S143
Binding residue
(residue number reindexed from 1)
N5 W6 T37 G44 D45 Q53 D57 D65 W67 E69 Y71 V74 S75 E136 F138 E139 E140 C141 N142 S143
Enzymatic activity
Catalytic site (original residue number in PDB) Q53 E136
Catalytic site (residue number reindexed from 1) Q53 E136
Enzyme Commision number 3.4.23.32: scytalidopepsin B.
Gene Ontology
Molecular Function
GO:0070007 glutamic-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2ifw, PDBe:2ifw, PDBj:2ifw
PDBsum2ifw
PubMed17069854
UniProtP15369|PRTB_SCYLI Scytalidopepsin B

[Back to BioLiP]