Structure of PDB 2ief Chain A Binding Site BS01

Receptor Information
>2ief Chain A (length=55) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKV
DLNRP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ief Structure of the cooperative Xis-DNA complex reveals a micronucleoprotein filament that regulates phage lambda intasome assembly.
Resolution2.601 Å
Binding residue
(original residue number in PDB)		R16 S17 E19 T20 R23 W24 R39
Binding residue
(residue number reindexed from 1)		R16 S17 E19 T20 R23 W24 R39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2ief, PDBe:2ief, PDBj:2ief
PDBsum2ief
PubMed17287355
UniProtP03699|VXIS_LAMBD Excisionase (Gene Name=xis)

[Back to BioLiP]