Structure of PDB 2ibf Chain A Binding Site BS01

Receptor Information
>2ibf Chain A (length=258) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAA
VSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPY
SVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEV
VETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKE
LLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQL
TSWDEDAW
Ligand information
>2ibf Chain B (length=25) Species: 623 (Shigella flexneri) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NHAIYEKAKEVSSALSKVLSKIDDT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ibf Vinculin binding in its closed conformation by a helix addition mechanism.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		T8 I12 V16 Q19 I20 K35 I37 P38 L40 P43 V44 V47 A50 L54 V57 T61 S112 I115 L123 F126 E130
Binding residue
(residue number reindexed from 1)		T8 I12 V16 Q19 I20 K35 I37 P38 L40 P43 V44 V47 A50 L54 V57 T61 S112 I115 L123 F126 E130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ibf, PDBe:2ibf, PDBj:2ibf
PDBsum2ibf
PubMed17932491
UniProtP18206|VINC_HUMAN Vinculin (Gene Name=VCL)

[Back to BioLiP]