Structure of PDB 2i9k Chain A Binding Site BS01

Receptor Information

>2i9k Chain A (length=327) Species: 726 (Haemophilus haemolyticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYE
MNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTL
FFDIARIVREKKPKVVFMENVKNAASHDNGNTLEVVKNTMNELDYSFHAK
VLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS
EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAIT
LSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY

Ligand information

>2i9k Chain C (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gatagcgctatc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2i9k Engineered Extrahelical Base Destabilization Enhances Sequence Discrimination of DNA Methyltransferase M.HhaI
Resolution	2.65 Å
Binding residue (original residue number in PDB)	Y44 I86 Q90 N123 K234 G236 Q237 G256 G257 S294 Q297
Binding residue (residue number reindexed from 1)	Y44 I86 Q90 N123 K234 G236 Q237 G256 G257 S294 Q297
Binding affinity	PDBbind-CN: Kd=0.3nM

Enzymatic activity

Enzyme Commision number

2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003886	DNA (cytosine-5-)-methyltransferase activity
GO:0008168	methyltransferase activity

	Biological Process
GO:0009307	DNA restriction-modification system
GO:0032259	methylation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2i9k, PDBe:2i9k, PDBj:2i9k
PDBsum	2i9k
PubMed	16919299
UniProt	P05102\|MTH1_HAEPH Type II methyltransferase M.HhaI (Gene Name=hhaIM)

[Back to BioLiP]