Structure of PDB 2i94 Chain A Binding Site BS01

Receptor Information
>2i94 Chain A (length=182) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFF
PEADPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFS
LYDVDGNGTISKNEVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWG
FFGKKDDDKLTEKEFIEGTLANKEILRLIQFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2i94 Structural Basis for Calcium-induced Inhibition of Rhodopsin Kinase by Recoverin.
ResolutionN/A
Binding residue
(original residue number in PDB)		W31 S34 E38 F49 I52 Y53 F56 F57 Y86 L90 T93 S94
Binding residue
(residue number reindexed from 1)		W24 S27 E31 F42 I45 Y46 F49 F50 Y79 L83 T86 S87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0007601 visual perception
GO:0007602 phototransduction
GO:0051924 regulation of calcium ion transport
Cellular Component
GO:0001750 photoreceptor outer segment
GO:0001917 photoreceptor inner segment
GO:0005829 cytosol
GO:0016020 membrane
GO:0042995 cell projection
GO:0043204 perikaryon

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2i94, PDBe:2i94, PDBj:2i94
PDBsum2i94
PubMed17020884
UniProtP21457|RECO_BOVIN Recoverin (Gene Name=RCVRN)

[Back to BioLiP]