Structure of PDB 2i2y Chain A Binding Site BS01

Receptor Information
>2i2y Chain A (length=150) Species: 1320,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATK
TFTVTEGSHHHHHHMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPL
RSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2i2y Molecular basis of RNA recognition and TAP binding by the SR proteins SRp20 and 9G8.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y77 W104 A106 R107 N108 F112 F114 E143 L144 S145 N146
Binding residue
(residue number reindexed from 1)		Y77 W104 A106 R107 N108 F112 F114 E143 L144 S145 N146
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Cellular Component
GO:0005618 cell wall

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2i2y, PDBe:2i2y, PDBj:2i2y
PDBsum2i2y
PubMed17036044
UniProtP19909|SPG2_STRSG Immunoglobulin G-binding protein G (Gene Name=spg);
P84103|SRSF3_HUMAN Serine/arginine-rich splicing factor 3 (Gene Name=SRSF3)

[Back to BioLiP]