Structure of PDB 2i04 Chain A Binding Site BS01

Receptor Information
>2i04 Chain A (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVI
VSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2i04 Structures of a Human Papillomavirus (HPV) E6 Polypeptide Bound to MAGUK Proteins: Mechanisms of Targeting Tumor Suppressors by a High-Risk HPV Oncoprotein.
Resolution2.15 Å
Binding residue
(original residue number in PDB)
G461 F462 F464 T465 V466 V467 G468 D470 K479 H512
Binding residue
(residue number reindexed from 1)
G12 F13 F15 T16 V17 V18 G19 D21 K30 H63
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2i04, PDBe:2i04, PDBj:2i04
PDBsum2i04
PubMed17267502
UniProtQ6RHR9|MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (Gene Name=Magi1)

[Back to BioLiP]