Structure of PDB 2hw8 Chain A Binding Site BS01

Receptor Information
>2hw8 Chain A (length=228) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGID
PRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEII
QKILDGWMDFDAVVATPDVMGAVGSKMGRILGPRGLLPNPKAGTVGFNIG
EIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHK
PEGAKGTFLRSVYVTTTMGPSVRINPHS
Ligand information
>2hw8 Chain B (length=36) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggggugaaggaggcuucggccgcgaaacuucacccc
<<<<<<<<<..<<<....>>>......>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hw8 Structure of the ribosomal protein L1-mRNA complex at 2.1 A resolution: common features of crystal packing of L1-RNA complexes.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		K2 H3 G4 R6 Y7 A35 K36 F37 T40 E42 H44 K46 K70 D166 K167 T168 H172 P174 S211 Y213 T215 T217 M218 G219 S221
Binding residue
(residue number reindexed from 1)		K2 H3 G4 R6 Y7 A35 K36 F37 T40 E42 H44 K46 K70 D166 K167 T168 H172 P174 S211 Y213 T215 T217 M218 G219 S221
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2hw8, PDBe:2hw8, PDBj:2hw8
PDBsum2hw8
PubMed17139090
UniProtP27150|RL1_THETH Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]