Structure of PDB 2hug Chain A Binding Site BS01

Receptor Information
>2hug Chain A (length=57) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKD
YEDGLEY
Ligand information
>2hug Chain B (length=14) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
APPGTARRKRKADS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hug Assembly of chloroplast signal recognition particle involves structural rearrangement in cpSRP43.
ResolutionN/A
Binding residue
(original residue number in PDB)		E6 Y7 A8 K21 V27 W29 E36 W37 V38 H42 V43 A44
Binding residue
(residue number reindexed from 1)		E6 Y7 A8 K21 V27 W29 E36 W37 V38 H42 V43 A44
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2hug, PDBe:2hug, PDBj:2hug
PDBsum2hug
PubMed18586266
UniProtO22265|SR43C_ARATH Signal recognition particle 43 kDa protein, chloroplastic (Gene Name=CAO)

[Back to BioLiP]