Structure of PDB 2hu2 Chain A Binding Site BS01

Receptor Information
>2hu2 Chain A (length=331) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALM
YHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASV
EETADSTLCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGE
TLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQD
LLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKAL
AQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASI
EMREEAAREIRRAITGRIPDSLKNCVNKDHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hu2 Specific Recognition of ZNF217 and Other Zinc Finger Proteins at a Surface Groove of C-Terminal Binding Proteins
Resolution2.85 Å
Binding residue
(original residue number in PDB)		E164 H218 D220 K242 Q243 M244 R245 Q246 G247 F249
Binding residue
(residue number reindexed from 1)		E150 H204 D206 K228 Q229 M230 R231 Q232 G233 F235
Enzymatic activity
Catalytic site (original residue number in PDB) S113 R255 D279 E284 H304
Catalytic site (residue number reindexed from 1) S99 R241 D265 E270 H290
Enzyme Commision number 1.1.1.-
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003714 transcription corepressor activity
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0051287 NAD binding
Biological Process
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2hu2, PDBe:2hu2, PDBj:2hu2
PDBsum2hu2
PubMed16940172
UniProtQ6AZ26

[Back to BioLiP]