Structure of PDB 2ht9 Chain A Binding Site BS01

Receptor Information
>2ht9 Chain A (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDL
LEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVH
QCYL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ht9 Reversible sequestration of active site cysteines in a 2Fe-2S-bridged dimer provides a mechanism for glutaredoxin 2 regulation in human mitochondria
Resolution1.9 Å
Binding residue
(original residue number in PDB)
K45 H48 Y54
Binding residue
(residue number reindexed from 1)
K34 H37 Y43
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2ht9, PDBe:2ht9, PDBj:2ht9
PDBsum2ht9
PubMed17121859
UniProtQ9NS18|GLRX2_HUMAN Glutaredoxin-2, mitochondrial (Gene Name=GLRX2)

[Back to BioLiP]