Structure of PDB 2ht1 Chain A Binding Site BS01

Receptor Information
>2ht1 Chain A (length=324) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIY
VSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFDKPENARNK
ILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP
KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVAS
TFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPA
SGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEV
IYEEFKGTGNMELHLSRKIAEKRV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ht1 Structural Insights into RNA-Dependent Ring Closure and ATPase Activation by the Rho Termination Factor.
Resolution3.51 Å
Binding residue
(original residue number in PDB)		L58 F64 G107 R109 Y110
Binding residue
(residue number reindexed from 1)		L28 F34 G77 R79 Y80
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008186 ATP-dependent activity, acting on RNA
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0042802 identical protein binding
Biological Process
GO:0006353 DNA-templated transcription termination
Cellular Component
GO:0005829 cytosol
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ht1, PDBe:2ht1, PDBj:2ht1
PDBsum2ht1
PubMed17081977
UniProtP0AG30|RHO_ECOLI Transcription termination factor Rho (Gene Name=rho)

[Back to BioLiP]