Structure of PDB 2ht0 Chain A Binding Site BS01

Receptor Information
>2ht0 Chain A (length=96) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGN
FDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ht0 Structure-based Analysis of HU-DNA Binding.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K45 R55 K57 P61 R63 R82 K88
Binding residue
(residue number reindexed from 1)		K44 R54 K56 P60 R62 R81 K87
Binding affinityPDBbind-CN: Kd=0.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009295 nucleoid
GO:0032993 protein-DNA complex
GO:1990177 IHF-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ht0, PDBe:2ht0, PDBj:2ht0
PDBsum2ht0
PubMed17097674
UniProtP0A6X7|IHFA_ECOLI Integration host factor subunit alpha (Gene Name=ihfA)

[Back to BioLiP]