Structure of PDB 2hsq Chain A Binding Site BS01

Receptor Information
>2hsq Chain A (length=261) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEHHHHHHMPVFHTRTIESILEPVAQQISHLVIMHEEKAIPDLTAPVAAV
QAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQS
DPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTV
AEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNT
VKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRV
LQLTSWDEDAW
Ligand information
>2hsq Chain B (length=23) Species: 623 (Shigella flexneri) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AIYEKAKEVSSALSKVLSKIDDT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hsq Shigella applies molecular mimicry to subvert vinculin and invade host cells.
Resolution3.97 Å
Binding residue
(original residue number in PDB)		I12 V16 Q19 I20 L23 I37 P38 L40 P43 V44 A50 L54 S112 L123 F126 D127
Binding residue
(residue number reindexed from 1)		I20 V24 Q27 I28 L31 I40 P41 L43 P46 V47 A53 L57 S115 L126 F129 D130
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2hsq, PDBe:2hsq, PDBj:2hsq
PDBsum2hsq
PubMed17088427
UniProtP18206|VINC_HUMAN Vinculin (Gene Name=VCL)

[Back to BioLiP]