Structure of PDB 2hos Chain A Binding Site BS01

Receptor Information
>2hos Chain A (length=56) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQVKGWFKNMRA
KIKKST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hos Structure and properties of a re-engineered homeodomain protein-DNA interface.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R5 T6 F8 N51
Binding residue
(residue number reindexed from 1)		R1 T2 F4 N47
Binding affinityPDBbind-CN: Kd=5.8nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2hos, PDBe:2hos, PDBj:2hos
PDBsum2hos
PubMed17240973
UniProtP02836|HMEN_DROME Segmentation polarity homeobox protein engrailed (Gene Name=en)

[Back to BioLiP]