Structure of PDB 2hmh Chain A Binding Site BS01

Receptor Information
>2hmh Chain A (length=121) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRH
FFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYM
PPQAYYIYKIPLVLSRPLSSN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hmh Structural basis for phosphotyrosine recognition by suppressor of cytokine signaling-3.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		N57 R71 S73 S74 T81 N92 L93 R94 Q105 S106 D107 S110 T111 Q112 P115 Y127 Y142 Y143 I144 Y145
Binding residue
(residue number reindexed from 1)		N29 R43 S45 S46 T53 N64 L65 R66 Q77 S78 D79 S82 T83 Q84 P87 Y99 Y105 Y106 I107 Y108
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2hmh, PDBe:2hmh, PDBj:2hmh
PDBsum2hmh
PubMed16905102
UniProtO35718|SOCS3_MOUSE Suppressor of cytokine signaling 3 (Gene Name=Socs3)

[Back to BioLiP]