Structure of PDB 2hl3 Chain A Binding Site BS01

Receptor Information
>2hl3 Chain A (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMSPLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDG
TVQGRKYFTCDEGHGIFVRQSQIQVF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hl3 Key interaction modes of dynamic +TIP networks.
Resolution2.03 Å
Binding residue
(original residue number in PDB)
F52 W57 K68 N69 I87 F88 Q93
Binding residue
(residue number reindexed from 1)
F31 W36 K47 N48 I66 F67 Q72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2hl3, PDBe:2hl3, PDBj:2hl3
PDBsum2hl3
PubMed16949363
UniProtQ14203|DCTN1_HUMAN Dynactin subunit 1 (Gene Name=DCTN1)

[Back to BioLiP]